Joint Open Genome and Omics Platform (JoGo)

Search by Genic region

Item	Value
geneid	9083
ensemblid	ENSG00000183753.10
hgncid	13508
symbol	BPY2
name	basic charge Y-linked 2
refseq_nuc	NM_004678.3
refseq_prot	NP_004669.2
ensembl_nuc	ENST00000331070.8
ensembl_prot	ENSP00000329106.3
mane_status	MANE Select
chr	chrY
start	22984263
end	23005465
strand	+
ver	v1.2
region	chrY:22984263-23005465
region5000	chrY:22979263-23010465
regionname0	BPY2_chrY_22984263_23005465
regionname5000	BPY2_chrY_22979263_23010465

ahapid	grch38/ chm13v2	alen	total	AFR	AMR	EAS	EUR	SAS	JPT	regionname	genename	aa	chr	start	end
a0001	0/0	106	49	2	14	18	4	11	7	BPY2_chrY_22979263_23010465	BPY2	MMTLV others(101): Show MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHR LLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVS RPRSQK	chrY	22979263	23010465
a0002	0/0	79	1	0	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	MMTLV others(74): Show MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHR LLKNGNVRNTLLQSKVGLLTYYVKLYPVK	chrY	22979263	23010465
a0003	0/0	33	1	0	0	1	0	0	1	BPY2_chrY_22979263_23010465	BPY2	MMTLV others(28): Show MMTLVPEPGHVQDRIITLIPAPDFHRCCLQRAS	chrY	22979263	23010465
a0004	0/0	34	1	0	0	1	0	0	1	BPY2_chrY_22979263_23010465	BPY2	MMTLV others(29): Show MMTLVPQSQGHVQDRIITLIPAPDFHRCCLQRAS	chrY	22979263	23010465

achapid	grch38/ chm13v2	clen	total	AFR	AMR	EAS	EUR	SAS	regionname	genename	cseq	chr	start	end
a0001c0001	0/0	318	49	2	14	18	4	11	BPY2_chrY_22979263_23010465	BPY2	ATGAT others(313): Show ATGATGACGCTTGTCCCCAGAGCCAGGACACGTGCAGGACAGGATCATTA CTCTCATCCCTGCCCCAGATTTTCACAGGTGCTGCTTACAGAGGGCATCA TGACATATTGCTTGACAAAGAACCTAAGTGATGTTAATATTCTGCATAGG TTGCTAAAAAATGGGAATGTGAGAAATACCTTGCTTCAGTCCAAAGTGGG CTTGCTGACATATTATGTGAAACTGTACCCGGGTGAAGTGACTCTTCTGA CTAGGCCCAGCATACAAATGAGATTATGCTGTATCACTGGCTCAGTGTCG AGGCCCAGATCACAGAAG	chrY	22979263	23010465
a0002c0003	0/0	317	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	ATGAT others(312): Show ATGATGACGCTTGTCCCCAGAGCCAGGACACGTGCAGGACAGGATCATTA CTCTCATCCCTGCCCCAGATTTTCACAGGTGCTGCTTACAGAGGGCATCA TGACATATTGCTTGACAAAGAACCTAAGTGATGTTAATATTCTGCATAGG TTGCTAAAAAATGGGAATGTGAGAAATACCTTGCTTCAGTCCAAAGTGGG CTTGCTGACATATTATGTGAAACTGTACCCGGTGAAGTGACTCTTCTGAC TAGGCCCAGCATACAAATGAGATTATGCTGTATCACTGGCTCAGTGTCGA GGCCCAGATCACAGAAG	chrY	22979263	23010465
a0003c0002	0/0	317	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	ATGAT others(312): Show ATGATGACGCTTGTCCCAGAGCCAGGACACGTGCAGGACAGGATCATTAC TCTCATCCCTGCCCCAGATTTTCACAGGTGCTGCTTACAGAGGGCATCAT GACATATTGCTTGACAAAGAACCTAAGTGATGTTAATATTCTGCATAGGT TGCTAAAAAATGGGAATGTGAGAAATACCTTGCTTCAGTCCAAAGTGGGC TTGCTGACATATTATGTGAAACTGTACCCGGGTGAAGTGACTCTTCTGAC TAGGCCCAGCATACAAATGAGATTATGCTGTATCACTGGCTCAGTGTCGA GGCCCAGATCACAGAAG	chrY	22979263	23010465
a0004c0004	0/0	320	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	ATGAT others(315): Show ATGATGACGCTTGTCCCCCAGAGCCAGGGACACGTGCAGGACAGGATCAT TACTCTCATCCCTGCCCCAGATTTTCACAGGTGCTGCTTACAGAGGGCAT CATGACATATTGCTTGACAAAGAACCTAAGTGATGTTAATATTCTGCATA GGTTGCTAAAAAATGGGAATGTGAGAAATACCTTGCTTCAGTCCAAAGTG GGCTTGCTGACATATTATGTGAAACTGTACCCGGGTGAAGTGACTCTTCT GACTAGGCCCAGCATACAAATGAGATTATGCTGTATCACTGGCTCAGTGT CGAGGCCCAGATCACAGAAG	chrY	22979263	23010465

acthapid	grch38 chm13v2	tlen	total	AFR	AMR	EAS	EUR	SAS	regionname	genename	tseq	chr	start	end
a0001c0001t0001	0/0	1206	48	2	14	18	4	10	BPY2_chrY_22979263_23010465	BPY2	AATAT others(1201): Show AATATCTCAGGACCCAGGACCATGTGATATGGGCCCAACACCTGGATGAT GTTACTCTTCTGCCTAGGTCATGCGTAAAGAGGGAATTAGGGCATATTGC TTGGCCCAGTCCCGTAATGATATGACTCTCCTGCTTGTGCCAGAGCCACA GAAGTGTGCTTGGTGACATAATCTTTGAGGCTGTCACATCACCAAGATTA TATTGTATCACTGGACCAGCATAAAGCTGACACTTCTGACTATGCCCAGC CTTCAAATAATACTACACTGTATAATTGGCTCAACACCCAGGTGATATTG TTCCATTTACCTGAGACCAGATAAAAAGCCTAATGATGACGCTTGTCCCC AGAGCCAGGACACGTGCAGGACAGGATCATTACTCTCATCCCTGCCCCAG ATTTTCACAGGTGCTGCTTACAGAGGGCATCATGACATATTGCTTGACAA AGAACCTAAGTGATGTTAATATTCTGCATAGGTTGCTAAAAAATGGGAAT GTGAGAAATACCTTGCTTCAGTCCAAAGTGGGCTTGCTGACATATTATGT GAAACTGTACCCGGGTGAAGTGACTCTTCTGACTAGGCCCAGCATACAAA TGAGATTATGCTGTATCACTGGCTCAGTGTCGAGGCCCAGATCACAGAAG TAATTGTGCCATATGTGGAACAAGCAGCTAAGCAATAGATAACATCCATC GTGGCTCTGCCTTCAAAGGGAAATTTTACATATGTCACTGGGACCATCAC CCAGATGATGTCCTGCCCACTAAAAGAATTGTGACATAACGCTGACTGCA AAAACTGGGTAATGCAACTCTCCTCTTTATTCTGGAGTCTGCCAAAACAA GGGATTATCACATATTGCGGAGTCCAGCACCCAGGTAAAATTTTGTCATA TACCCAGCTTCAGATACCATGCAATAATACAACTATCATACCTGGACCCA AAGAGGAGAGATATTTTGATTCTCATTGCCATTCTTATGGCCACAAGCAA AGTAATGGTTCTCATAGTGGTATAAAGTTCACACAGTATTATGACACTCC CAGCGTATCATAGAAAATGTGAGTAGTACAATGAGTGTTATAACAGGGAA CAGCAAACCAATGCTATTGTGATTATTGGATTCACACCCAGCTGACGCGA CTATCATTCTCTCACAAGAACAGAACCTGCAAATAAAGTACTAAATCTCA CCAAAA	chrY	22979263	23010465
a0001c0001t0002	0/0	1205	1	0	0	0	0	1	BPY2_chrY_22979263_23010465	BPY2	AATAT others(1200): Show AATATCTCAGGACCCAGGACCATGTGATATGGGCCCAACACCTGGATGAT GTTACTCTTCTGCCTAGGTCATGCGTAAAGAGGGAATTAGGGCATATTGC TTGGCCCAGTCCCGTAATGATATGACTCTCCTGCTTGTGCCAGAGCCACA GAAGTGTGCTTGGTGACATAATCTTTGAGGCTGTCACATCACCAAGATTA TATTGTATCACTGGACCAGCATAAAGCTGACACTTCTGACTATGCCCAGC CTTCAAATAATACTACACTGTATAATTGGCTCAACACCCAGGTGATATTG TTCCATTACCTGAGACCAGATAAAAAGCCTAATGATGACGCTTGTCCCCA GAGCCAGGACACGTGCAGGACAGGATCATTACTCTCATCCCTGCCCCAGA TTTTCACAGGTGCTGCTTACAGAGGGCATCATGACATATTGCTTGACAAA GAACCTAAGTGATGTTAATATTCTGCATAGGTTGCTAAAAAATGGGAATG TGAGAAATACCTTGCTTCAGTCCAAAGTGGGCTTGCTGACATATTATGTG AAACTGTACCCGGGTGAAGTGACTCTTCTGACTAGGCCCAGCATACAAAT GAGATTATGCTGTATCACTGGCTCAGTGTCGAGGCCCAGATCACAGAAGT AATTGTGCCATATGTGGAACAAGCAGCTAAGCAATAGATAACATCCATCG TGGCTCTGCCTTCAAAGGGAAATTTTACATATGTCACTGGGACCATCACC CAGATGATGTCCTGCCCACTAAAAGAATTGTGACATAACGCTGACTGCAA AAACTGGGTAATGCAACTCTCCTCTTTATTCTGGAGTCTGCCAAAACAAG GGATTATCACATATTGCGGAGTCCAGCACCCAGGTAAAATTTTGTCATAT ACCCAGCTTCAGATACCATGCAATAATACAACTATCATACCTGGACCCAA AGAGGAGAGATATTTTGATTCTCATTGCCATTCTTATGGCCACAAGCAAA GTAATGGTTCTCATAGTGGTATAAAGTTCACACAGTATTATGACACTCCC AGCGTATCATAGAAAATGTGAGTAGTACAATGAGTGTTATAACAGGGAAC AGCAAACCAATGCTATTGTGATTATTGGATTCACACCCAGCTGACGCGAC TATCATTCTCTCACAAGAACAGAACCTGCAAATAAAGTACTAAATCTCAC CAAAA	chrY	22979263	23010465
a0002c0003t0001	0/0	1205	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	AATAT others(1200): Show AATATCTCAGGACCCAGGACCATGTGATATGGGCCCAACACCTGGATGAT GTTACTCTTCTGCCTAGGTCATGCGTAAAGAGGGAATTAGGGCATATTGC TTGGCCCAGTCCCGTAATGATATGACTCTCCTGCTTGTGCCAGAGCCACA GAAGTGTGCTTGGTGACATAATCTTTGAGGCTGTCACATCACCAAGATTA TATTGTATCACTGGACCAGCATAAAGCTGACACTTCTGACTATGCCCAGC CTTCAAATAATACTACACTGTATAATTGGCTCAACACCCAGGTGATATTG TTCCATTTACCTGAGACCAGATAAAAAGCCTAATGATGACGCTTGTCCCC AGAGCCAGGACACGTGCAGGACAGGATCATTACTCTCATCCCTGCCCCAG ATTTTCACAGGTGCTGCTTACAGAGGGCATCATGACATATTGCTTGACAA AGAACCTAAGTGATGTTAATATTCTGCATAGGTTGCTAAAAAATGGGAAT GTGAGAAATACCTTGCTTCAGTCCAAAGTGGGCTTGCTGACATATTATGT GAAACTGTACCCGGTGAAGTGACTCTTCTGACTAGGCCCAGCATACAAAT GAGATTATGCTGTATCACTGGCTCAGTGTCGAGGCCCAGATCACAGAAGT AATTGTGCCATATGTGGAACAAGCAGCTAAGCAATAGATAACATCCATCG TGGCTCTGCCTTCAAAGGGAAATTTTACATATGTCACTGGGACCATCACC CAGATGATGTCCTGCCCACTAAAAGAATTGTGACATAACGCTGACTGCAA AAACTGGGTAATGCAACTCTCCTCTTTATTCTGGAGTCTGCCAAAACAAG GGATTATCACATATTGCGGAGTCCAGCACCCAGGTAAAATTTTGTCATAT ACCCAGCTTCAGATACCATGCAATAATACAACTATCATACCTGGACCCAA AGAGGAGAGATATTTTGATTCTCATTGCCATTCTTATGGCCACAAGCAAA GTAATGGTTCTCATAGTGGTATAAAGTTCACACAGTATTATGACACTCCC AGCGTATCATAGAAAATGTGAGTAGTACAATGAGTGTTATAACAGGGAAC AGCAAACCAATGCTATTGTGATTATTGGATTCACACCCAGCTGACGCGAC TATCATTCTCTCACAAGAACAGAACCTGCAAATAAAGTACTAAATCTCAC CAAAA	chrY	22979263	23010465
a0003c0002t0003	0/0	1206	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	AATAT others(1201): Show AATATCTCAGGACCCAGGACCATGTGATATGGGCCCAACACCTGGATGAT GTTACTCTTCTGCCTAGGTCATGCGTAAAGAGGGAATTAGGGCATATTGC TTGGCCCAGTCCCGTAATGATATGACTCTCCTGCTTGTGCCAGAGCCACA GAAGTGTGCTTGGTGACATAATCTTTGAGGCTGTCACATCACCAAGATTA TATTGTATCACTGGACCAGCATAAAGCTGACACTTCTGACTATGCCCAGC CTTCAAATAATACTACACTGTATAATTGGCTCAACACCCAGGTGATATTG TTCCATTTACCTGAGACCAGTATAAAAAGCCTAATGATGACGCTTGTCCC AGAGCCAGGACACGTGCAGGACAGGATCATTACTCTCATCCCTGCCCCAG ATTTTCACAGGTGCTGCTTACAGAGGGCATCATGACATATTGCTTGACAA AGAACCTAAGTGATGTTAATATTCTGCATAGGTTGCTAAAAAATGGGAAT GTGAGAAATACCTTGCTTCAGTCCAAAGTGGGCTTGCTGACATATTATGT GAAACTGTACCCGGGTGAAGTGACTCTTCTGACTAGGCCCAGCATACAAA TGAGATTATGCTGTATCACTGGCTCAGTGTCGAGGCCCAGATCACAGAAG TAATTGTGCCATATGTGGAACAAGCAGCTAAGCAATAGATAACATCCATC GTGGCTCTGCCTTCAAAGGGAAATTTTACATATGTCACTGGGACCATCAC CCAGATGATGTCCTGCCCACTAAAAGAATTGTGACATAACGCTGACTGCA AAAACTGGGTAATGCAACTCTCCTCTTTATTCTGGAGTCTGCCAAAACAA GGGATTATCACATATTGCGGAGTCCAGCACCCAGGTAAAATTTTGTCATA TACCCAGCTTCAGATACCATGCAATAATACAACTATCATACCTGGACCCA AAGAGGAGAGATATTTTGATTCTCATTGCCATTCTTATGGCCACAAGCAA AGTAATGGTTCTCATAGTGGTATAAAGTTCACACAGTATTATGACACTCC CAGCGTATCATAGAAAATGTGAGTAGTACAATGAGTGTTATAACAGGGAA CAGCAAACCAATGCTATTGTGATTATTGGATTCACACCCAGCTGACGCGA CTATCATTCTCTCACAAGAACAGAACCTGCAAATAAAGTACTAAATCTCA CCAAAA	chrY	22979263	23010465
a0004c0004t0001	0/0	1208	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	AATAT others(1203): Show AATATCTCAGGACCCAGGACCATGTGATATGGGCCCAACACCTGGATGAT GTTACTCTTCTGCCTAGGTCATGCGTAAAGAGGGAATTAGGGCATATTGC TTGGCCCAGTCCCGTAATGATATGACTCTCCTGCTTGTGCCAGAGCCACA GAAGTGTGCTTGGTGACATAATCTTTGAGGCTGTCACATCACCAAGATTA TATTGTATCACTGGACCAGCATAAAGCTGACACTTCTGACTATGCCCAGC CTTCAAATAATACTACACTGTATAATTGGCTCAACACCCAGGTGATATTG TTCCATTTACCTGAGACCAGATAAAAAGCCTAATGATGACGCTTGTCCCC CAGAGCCAGGGACACGTGCAGGACAGGATCATTACTCTCATCCCTGCCCC AGATTTTCACAGGTGCTGCTTACAGAGGGCATCATGACATATTGCTTGAC AAAGAACCTAAGTGATGTTAATATTCTGCATAGGTTGCTAAAAAATGGGA ATGTGAGAAATACCTTGCTTCAGTCCAAAGTGGGCTTGCTGACATATTAT GTGAAACTGTACCCGGGTGAAGTGACTCTTCTGACTAGGCCCAGCATACA AATGAGATTATGCTGTATCACTGGCTCAGTGTCGAGGCCCAGATCACAGA AGTAATTGTGCCATATGTGGAACAAGCAGCTAAGCAATAGATAACATCCA TCGTGGCTCTGCCTTCAAAGGGAAATTTTACATATGTCACTGGGACCATC ACCCAGATGATGTCCTGCCCACTAAAAGAATTGTGACATAACGCTGACTG CAAAAACTGGGTAATGCAACTCTCCTCTTTATTCTGGAGTCTGCCAAAAC AAGGGATTATCACATATTGCGGAGTCCAGCACCCAGGTAAAATTTTGTCA TATACCCAGCTTCAGATACCATGCAATAATACAACTATCATACCTGGACC CAAAGAGGAGAGATATTTTGATTCTCATTGCCATTCTTATGGCCACAAGC AAAGTAATGGTTCTCATAGTGGTATAAAGTTCACACAGTATTATGACACT CCCAGCGTATCATAGAAAATGTGAGTAGTACAATGAGTGTTATAACAGGG AACAGCAAACCAATGCTATTGTGATTATTGGATTCACACCCAGCTGACGC GACTATCATTCTCTCACAAGAACAGAACCTGCAAATAAAGTACTAAATCT CACCAAAA	chrY	22979263	23010465

actghapid	grch38/ chm13v2	total	AFR	AMR	EAS	EUR	SAS	regionname	genename	chr	start	end
a0001c0001t0001g0001	0/0	9	0	0	1	0	8	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0002	0/0	7	0	6	0	1	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0003	0/0	6	1	2	2	0	1	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0004	0/0	2	0	0	2	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0005	0/0	2	0	0	2	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0006	0/0	1	0	0	0	1	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0007	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0010	0/0	1	0	0	0	0	1	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0011	0/0	1	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0012	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0013	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0015	0/0	1	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0016	0/0	1	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0017	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0018	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0019	0/0	1	0	0	0	1	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0020	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0021	0/0	1	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0022	0/0	1	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0023	0/0	1	0	1	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0024	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0025	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0026	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0027	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0028	0/0	1	1	0	0	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0029	0/0	1	0	0	0	1	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0001g0030	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0001c0001t0002g0009	0/0	1	0	0	0	0	1	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0002c0003t0001g0014	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0003c0002t0003g0031	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
a0004c0004t0001g0008	0/0	1	0	0	1	0	0	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465

sampleid	ID haplotypeid	ahapid	chapid	thapid	ghapid	gpopname	popname	regionname	genename	chr	start	end
HG00280	hp1	a0001	c0001	t0001	g0019	EUR	FIN	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG00609	hp1	a0001	c0001	t0001	g0007	EAS	CHS	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG00621	hp1	a0001	c0001	t0001	g0027	EAS	CHS	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG00642	hp1	a0001	c0001	t0001	g0015	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG00673	hp1	a0001	c0001	t0001	g0018	EAS	CHS	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG00738	hp1	a0001	c0001	t0001	g0002	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01074	hp1	a0001	c0001	t0001	g0016	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01099	hp1	a0001	c0001	t0001	g0003	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01106	hp1	a0001	c0001	t0001	g0022	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01192	hp1	a0001	c0001	t0001	g0003	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01243	hp1	a0001	c0001	t0001	g0002	AMR	PUR	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01261	hp1	a0001	c0001	t0001	g0002	AMR	CLM	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01358	hp1	a0001	c0001	t0001	g0002	AMR	CLM	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01433	hp1	a0001	c0001	t0001	g0023	AMR	CLM	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01515	hp1	a0001	c0001	t0001	g0029	EUR	IBS	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01928	hp1	a0001	c0001	t0001	g0021	AMR	PEL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01934	hp1	a0001	c0001	t0001	g0002	AMR	PEL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01943	hp1	a0001	c0001	t0001	g0002	AMR	PEL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG01952	hp1	a0001	c0001	t0001	g0011	AMR	PEL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02015	hp2	a0001	c0001	t0001	g0012	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02027	hp1	a0001	c0001	t0001	g0003	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02040	hp1	a0002	c0003	t0001	g0014	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02056	hp1	a0001	c0001	t0001	g0024	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02071	hp1	a0001	c0001	t0001	g0026	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02074	hp1	a0001	c0001	t0001	g0004	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02083	hp1	a0001	c0001	t0001	g0004	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02132	hp1	a0001	c0001	t0001	g0001	EAS	KHV	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02602	hp1	a0001	c0001	t0001	g0001	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02698	hp1	a0001	c0001	t0001	g0010	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02735	hp1	a0001	c0001	t0002	g0009	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG02738	hp1	a0001	c0001	t0001	g0001	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG03017	hp1	a0001	c0001	t0001	g0001	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG03098	hp1	a0001	c0001	t0001	g0028	AFR	MSL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG03490	hp1	a0001	c0001	t0001	g0001	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG03492	hp1	a0001	c0001	t0001	g0001	SAS	PJL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG03579	hp1	a0001	c0001	t0001	g0003	AFR	MSL	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG04115	hp1	a0001	c0001	t0001	g0001	SAS	STU	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG04204	hp1	a0001	c0001	t0001	g0001	SAS	STU	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
HG04228	hp1	a0001	c0001	t0001	g0001	SAS	STU	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18747	hp1	a0001	c0001	t0001	g0020	EAS	CHB	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18962	hp1	a0001	c0001	t0001	g0003	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18971	hp1	a0001	c0001	t0001	g0005	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18974	hp1	a0001	c0001	t0001	g0005	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18977	hp1	a0001	c0001	t0001	g0013	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18989	hp1	a0003	c0002	t0003	g0031	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA18994	hp1	a0001	c0001	t0001	g0030	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA19007	hp1	a0001	c0001	t0001	g0017	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA19009	hp1	a0004	c0004	t0001	g0008	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA19060	hp1	a0001	c0001	t0001	g0025	EAS	JPT	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA20752	hp1	a0001	c0001	t0001	g0002	EUR	TSI	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA20805	hp1	a0001	c0001	t0001	g0006	EUR	TSI	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465
NA20905	hp1	a0001	c0001	t0001	g0003	SAS	GIH	BPY2_chrY_22979263_23010465	BPY2	chrY	22979263	23010465

chr:pos	ref	alt	# # of ahapid:amino-acid(protein) level	ahapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	hgvs_p	genename	geneid	featuretype	featureid	transcript_biotype	rank	cdna cdna pos length	cds cds pos length	aa aa pos length	status	chr	pos
chrY:22992357	T T	TC TC	1	a0004 a0004	1	NA19009.hp1 NA19009.hp1	frameshift_variant	HIGH	c.18dupC c.18dupC	p.Arg7fs p.Arg7fs	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/9	351/1206	19/321	7/106	INFO_REALIGN_3_PRIME	chrY	22992357
chrY:22992357	TC TC	T T	1	a0003 a0003	1	NA18989.hp1 NA18989.hp1	frameshift_variant	HIGH	c.18delC c.18delC	p.Arg7fs p.Arg7fs	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/9	350/1206	18/321	6/106	INFO_REALIGN_3_PRIME	chrY	22992357
chrY:22992368	A A	AG AG	1	a0004 a0004	1	NA19009.hp1 NA19009.hp1	frameshift_variant	HIGH	c.27dupG c.27dupG	p.Thr10fs p.Thr10fs	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/9	360/1206	28/321	10/106	INFO_REALIGN_3_PRIME	chrY	22992368
chrY:22997485	CG CG	C C	1	a0002 a0002	1	HG02040.hp1 HG02040.hp1	frameshift_variant	HIGH	c.233delG c.233delG	p.Gly78fs p.Gly78fs	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/9	565/1206	233/321	78/106	INFO_REALIGN_3_PRIME	chrY	22997485

view	chr:pos	ref	alt	# # of chapid	chapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	hgvs_p	genename	geneid	featuretype	featureid	transcript_biotype	rank	cdna cdna pos length	cds cds pos length	aa aa pos length	distance	status	chr	pos

view	chr:pos	ref	alt	# # of thapid:transcript level	thapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	hgvs_p	genename	geneid	featuretype	featureid	transcript_biotype	rank	cdna cdna pos length	cds cds pos length	aa aa pos length	distance	status	chr	pos
	chrY:22992316	AT AT	A A	1	a0001c0001t0002 a0001c0001t0002	1	HG02735.hp1 HG02735.hp1	5_prime_UTR_variant	MODIFIER	c.-25delT c.-25delT		BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/9				25	INFO_REALIGN_3_PRIME	chrY	22992316
	chrY:22992331	G G	GT GT	1	a0003c0002t0003 a0003c0002t0003	1	NA18989.hp1 NA18989.hp1	5_prime_UTR_variant	MODIFIER	c.-13_-12insT c.-13_-12insT		BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/9				12		chrY	22992331

chr:pos	ref	alt	# # of ghapid:genebody level	ghapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	genename	geneid	featuretype	featureid	genebody_biotype	rank	status	chr	pos
chrY:22984796	A A	C C	2	a0001c0001t0001g0005 a0003c0002t0003g0031 a0001c0001t0001g0005 a0003c0002t0003g0031	3	NA18971.hp1 NA18974.hp1 NA18989.hp1 NA18971.hp1 NA18974.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-179+105A>C c.-179+105A>C	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22984796
chrY:22985638	CT CT	C C	1	a0001c0001t0001g0006 a0001c0001t0001g0006	1	NA20805.hp1 NA20805.hp1	intron_variant	MODIFIER	c.-179+950delT c.-179+950delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22985638
chrY:22985764	GC GC	G G	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-179+1076delC c.-179+1076delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22985764
chrY:22986030	C C	CTA CTA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-179+1339_-179+134 others(6): Show c.-179+1339_-179+1340insTA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22986030
chrY:22986125	GC GC	G G	1	a0001c0001t0001g0006 a0001c0001t0001g0006	1	NA20805.hp1 NA20805.hp1	intron_variant	MODIFIER	c.-179+1437delC c.-179+1437delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986125
chrY:22986143	TG TG	T T	1	a0001c0001t0001g0006 a0001c0001t0001g0006	1	NA20805.hp1 NA20805.hp1	intron_variant	MODIFIER	c.-179+1455delG c.-179+1455delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986143
chrY:22986148	G G	C C	29	a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0004 others(26): Show a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0004 a0001c0001t0001g0005 a0001c0001t0001g0006 a0001c0001t0001g0007 a0001c0001t0001g0010 a0001c0001t0001g0011 a0001c0001t0001g0012 a0001c0001t0001g0013 a0001c0001t0001g0015 a0001c0001t0001g0016 a0001c0001t0001g0017 a0001c0001t0001g0018 a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0021 a0001c0001t0001g0022 a0001c0001t0001g0023 a0001c0001t0001g0024 a0001c0001t0001g0025 a0001c0001t0001g0026 a0001c0001t0001g0027 a0001c0001t0001g0028 a0001c0001t0001g0030 a0001c0001t0002g0009 a0002c0003t0001g0014 a0003c0002t0003g0031 a0004c0004t0001g0008	44	HG00280.hp1 HG00609.hp1 HG00621.hp1 others(41): Show HG00280.hp1 HG00609.hp1 HG00621.hp1 HG00642.hp1 HG00673.hp1 HG01074.hp1 HG01099.hp1 HG01106.hp1 HG01192.hp1 HG01433.hp1 HG01928.hp1 HG01952.hp1 HG02015.hp2 HG02027.hp1 HG02040.hp1 HG02056.hp1 HG02071.hp1 HG02074.hp1 HG02083.hp1 HG02132.hp1 HG02602.hp1 HG02698.hp1 HG02735.hp1 HG02738.hp1 HG03017.hp1 HG03098.hp1 HG03490.hp1 HG03492.hp1 HG03579.hp1 HG04115.hp1 HG04204.hp1 HG04228.hp1 NA18747.hp1 NA18962.hp1 NA18971.hp1 NA18974.hp1 NA18977.hp1 NA18989.hp1 NA18994.hp1 NA19007.hp1 NA19009.hp1 NA19060.hp1 NA20805.hp1 NA20905.hp1	intron_variant	MODIFIER	c.-179+1457G>C c.-179+1457G>C	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22986148
chrY:22986270	T T	TTC TTC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-1483_-178-148 others(6): Show c.-178-1483_-178-1482dupCT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986270
chrY:22986277	G G	GAACCA GAACCA	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-178-1479_-178-147 others(9): Show c.-178-1479_-178-1475dupAACCA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986277
chrY:22986344	T T	TC TC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-1413_-178-141 others(5): Show c.-178-1413_-178-1412insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22986344
chrY:22986452	C C	CA CA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-1304dupA c.-178-1304dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986452
chrY:22986504	T T	TA TA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-1253_-178-125 others(5): Show c.-178-1253_-178-1252insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22986504
chrY:22986560	C C	G G	1	a0001c0001t0001g0027 a0001c0001t0001g0027	1	HG00621.hp1 HG00621.hp1	intron_variant	MODIFIER	c.-178-1197C>G c.-178-1197C>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22986560
chrY:22986560	C C	T T	1	a0001c0001t0001g0028 a0001c0001t0001g0028	1	HG03098.hp1 HG03098.hp1	intron_variant	MODIFIER	c.-178-1197C>T c.-178-1197C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22986560
chrY:22986721	CA CA	C C	1	a0001c0001t0001g0006 a0001c0001t0001g0006	1	NA20805.hp1 NA20805.hp1	intron_variant	MODIFIER	c.-178-1033delA c.-178-1033delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986721
chrY:22986736	G G	GC GC	1	a0001c0001t0001g0006 a0001c0001t0001g0006	1	NA20805.hp1 NA20805.hp1	intron_variant	MODIFIER	c.-178-1019dupC c.-178-1019dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986736
chrY:22986940	C C	CA CA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-814dupA c.-178-814dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22986940
chrY:22987086	G G	GTA GTA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-671_-178-670i others(4): Show c.-178-671_-178-670insTA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22987086
chrY:22987087	A A	G G	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-670A>G c.-178-670A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22987087
chrY:22987120	AC AC	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-178-635delC c.-178-635delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987120
chrY:22987130	A A	AG AG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-624dupG c.-178-624dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987130
chrY:22987247	G G	GA GA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-507dupA c.-178-507dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987247
chrY:22987281	T T	TC TC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-475dupC c.-178-475dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987281
chrY:22987304	C C	CA CA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-453_-178-452i others(3): Show c.-178-453_-178-452insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8		chrY	22987304
chrY:22987317	CA CA	C C	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-436delA c.-178-436delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987317
chrY:22987376	C C	CT CT	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-178-378dupT c.-178-378dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987376
chrY:22987519	GC GC	G G	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-178-233delC c.-178-233delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987519
chrY:22987604	G G	GT GT	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-178-151dupT c.-178-151dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987604
chrY:22987672	GC GC	G G	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-178-83delC c.-178-83delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	2/8	INFO_REALIGN_3_PRIME	chrY	22987672
chrY:22987935	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+42_-42+43insG c.-42+42_-42+43insG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22987935
chrY:22987952	GT GT	G G	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-42+61delT c.-42+61delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22987952
chrY:22988070	G G	GT GT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+179dupT c.-42+179dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988070
chrY:22988246	T T	TA TA	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+360dupA c.-42+360dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988246
chrY:22988303	T T	TG TG	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-42+412dupG c.-42+412dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988303
chrY:22988314	A A	C C	1	a0001c0001t0001g0028 a0001c0001t0001g0028	1	HG03098.hp1 HG03098.hp1	intron_variant	MODIFIER	c.-42+421A>C c.-42+421A>C	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988314
chrY:22988315	G G	A A	1	a0001c0001t0001g0028 a0001c0001t0001g0028	1	HG03098.hp1 HG03098.hp1	intron_variant	MODIFIER	c.-42+422G>A c.-42+422G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988315
chrY:22988351	T T	TC TC	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-42+459dupC c.-42+459dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988351
chrY:22988377	AG AG	A A	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-42+489delG c.-42+489delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988377
chrY:22988379	G G	A A	2	a0001c0001t0001g0006 a0001c0001t0002g0009 a0001c0001t0001g0006 a0001c0001t0002g0009	2	HG02735.hp1 NA20805.hp1 HG02735.hp1 NA20805.hp1	intron_variant	MODIFIER	c.-42+486G>A c.-42+486G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988379
chrY:22988385	TG TG	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+496delG c.-42+496delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988385
chrY:22988403	A A	G G	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+510A>G c.-42+510A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988403
chrY:22988514	G G	A A	1	a0001c0001t0001g0010 a0001c0001t0001g0010	1	HG02698.hp1 HG02698.hp1	intron_variant	MODIFIER	c.-42+621G>A c.-42+621G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988514
chrY:22988534	T T	G G	1	a0001c0001t0001g0010 a0001c0001t0001g0010	1	HG02698.hp1 HG02698.hp1	intron_variant	MODIFIER	c.-42+641T>G c.-42+641T>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988534
chrY:22988582	A A	AG AG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+691dupG c.-42+691dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988582
chrY:22988594	CG CG	C C	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-42+703delG c.-42+703delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988594
chrY:22988617	G G	GA GA	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-42+726dupA c.-42+726dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988617
chrY:22988774	G G	GA GA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+883dupA c.-42+883dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988774
chrY:22988799	GC GC	G G	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-42+909delC c.-42+909delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988799
chrY:22988875	CA CA	C C	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG00609.hp1 HG00609.hp1	intron_variant	MODIFIER	c.-42+984delA c.-42+984delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988875
chrY:22988879	TG TG	T T	1	a0001c0001t0001g0011 a0001c0001t0001g0011	1	HG01952.hp1 HG01952.hp1	intron_variant	MODIFIER	c.-42+988delG c.-42+988delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988879
chrY:22988892	C C	CA CA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1000dupA c.-42+1000dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988892
chrY:22988929	GC GC	G G	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-42+1037delC c.-42+1037delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988929
chrY:22988954	GA GA	G G	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1062delA c.-42+1062delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988954
chrY:22988963	A A	AC AC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1071dupC c.-42+1071dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22988963
chrY:22988966	T T	C C	1	a0001c0001t0001g0012 a0001c0001t0001g0012	1	HG02015.hp2 HG02015.hp2	intron_variant	MODIFIER	c.-42+1073T>C c.-42+1073T>C	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988966
chrY:22988970	T T	TTC TTC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1077_-42+1078i others(4): Show c.-42+1077_-42+1078insTC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988970
chrY:22988971	C C	T T	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1078C>T c.-42+1078C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22988971
chrY:22989016	C C	CT CT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1123_-42+1124i others(3): Show c.-42+1123_-42+1124insT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989016
chrY:22989050	AT AT	A A	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1159delT c.-42+1159delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989050
chrY:22989091	GC GC	G G	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1201delC c.-42+1201delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989091
chrY:22989163	TC TC	T T	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-42+1272delC c.-42+1272delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989163
chrY:22989247	A A	AC AC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1354_-42+1355i others(3): Show c.-42+1354_-42+1355insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989247
chrY:22989302	C C	CT CT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1410dupT c.-42+1410dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989302
chrY:22989338	T T	TC TC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1446dupC c.-42+1446dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989338
chrY:22989438	A A	AC AC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1546dupC c.-42+1546dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989438
chrY:22989490	A A	AT AT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1598dupT c.-42+1598dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989490
chrY:22989539	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1647dupG c.-42+1647dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989539
chrY:22989565	AT AT	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+1676delT c.-42+1676delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989565
chrY:22989589	T T	C C	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+1696T>C c.-42+1696T>C	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989589
chrY:22989590	C C	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+1697C>T c.-42+1697C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989590
chrY:22989591	T T	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-42+1698T>A c.-42+1698T>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989591
chrY:22989643	AG AG	A A	1	a0001c0001t0001g0027 a0001c0001t0001g0027	1	HG00621.hp1 HG00621.hp1	intron_variant	MODIFIER	c.-42+1752delG c.-42+1752delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989643
chrY:22989788	C C	CA CA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1898dupA c.-42+1898dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989788
chrY:22989806	A A	AT AT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1916dupT c.-42+1916dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989806
chrY:22989813	G G	GC GC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+1922dupC c.-42+1922dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989813
chrY:22989863	A A	G G	1	a0001c0001t0001g0024 a0001c0001t0001g0024	1	HG02056.hp1 HG02056.hp1	intron_variant	MODIFIER	c.-42+1970A>G c.-42+1970A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989863
chrY:22989869	A A	AT AT	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-42+1979dupT c.-42+1979dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989869
chrY:22989874	T T	TA TA	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-42+1982dupA c.-42+1982dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989874
chrY:22989968	G G	A A	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.-42+2075G>A c.-42+2075G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22989968
chrY:22989989	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+2098dupG c.-42+2098dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22989989
chrY:22990028	T T	TC TC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+2136dupC c.-42+2136dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990028
chrY:22990053	A A	AC AC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+2161dupC c.-42+2161dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990053
chrY:22990073	G G	GT GT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-42+2182dupT c.-42+2182dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990073
chrY:22990108	AG AG	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-2193delG c.-41-2193delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990108
chrY:22990122	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-2178dupG c.-41-2178dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990122
chrY:22990147	AT AT	A A	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-41-2155delT c.-41-2155delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990147
chrY:22990271	TA TA	T T	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-2029delA c.-41-2029delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990271
chrY:22990290	G G	GC GC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-2010dupC c.-41-2010dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990290
chrY:22990293	C C	A A	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-2010C>A c.-41-2010C>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990293
chrY:22990294	A A	G G	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-2009A>G c.-41-2009A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990294
chrY:22990295	G G	A A	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-2008G>A c.-41-2008G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990295
chrY:22990369	GA GA	G G	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-1933delA c.-41-1933delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990369
chrY:22990381	T T	A A	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1922T>A c.-41-1922T>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990381
chrY:22990396	A A	AC AC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1905dupC c.-41-1905dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990396
chrY:22990436	T T	TA TA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1867_-41-1866i others(3): Show c.-41-1867_-41-1866insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990436
chrY:22990453	C C	CT CT	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-1849dupT c.-41-1849dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990453
chrY:22990467	TA TA	T T	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-41-1834delA c.-41-1834delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990467
chrY:22990484	T T	TC TC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1819_-41-1818i others(3): Show c.-41-1819_-41-1818insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990484
chrY:22990491	AC AC	A A	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.-41-1809delC c.-41-1809delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990491
chrY:22990518	T T	TA TA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1784dupA c.-41-1784dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990518
chrY:22990565	G G	GC GC	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-1735dupC c.-41-1735dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990565
chrY:22990570	GC GC	G G	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-1731delC c.-41-1731delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990570
chrY:22990607	A A	G G	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.-41-1696A>G c.-41-1696A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990607
chrY:22990630	G G	GC GC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1671dupC c.-41-1671dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990630
chrY:22990680	C C	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-1623C>A c.-41-1623C>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22990680
chrY:22990772	GC GC	G G	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-1528delC c.-41-1528delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990772
chrY:22990817	GT GT	G G	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.-41-1483delT c.-41-1483delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990817
chrY:22990868	GT GT	G G	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-1433delT c.-41-1433delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990868
chrY:22990938	CT CT	C C	1	a0001c0001t0001g0011 a0001c0001t0001g0011	1	HG01952.hp1 HG01952.hp1	intron_variant	MODIFIER	c.-41-1363delT c.-41-1363delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990938
chrY:22990957	CA CA	C C	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.-41-1343delA c.-41-1343delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22990957
chrY:22991066	A A	AC AC	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-1236dupC c.-41-1236dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991066
chrY:22991068	AG AG	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-1233delG c.-41-1233delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991068
chrY:22991071	C C	CA CA	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-1231dupA c.-41-1231dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991071
chrY:22991275	A A	AG AG	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.-41-1026dupG c.-41-1026dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991275
chrY:22991380	C C	CA CA	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-920dupA c.-41-920dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991380
chrY:22991425	TG TG	T T	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-875delG c.-41-875delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991425
chrY:22991458	A A	AT AT	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-840dupT c.-41-840dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991458
chrY:22991623	C C	T T	1	a0001c0001t0001g0004 a0001c0001t0001g0004	2	HG02074.hp1 HG02083.hp1 HG02074.hp1 HG02083.hp1	intron_variant	MODIFIER	c.-41-680C>T c.-41-680C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22991623
chrY:22991631	GC GC	G G	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.-41-669delC c.-41-669delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991631
chrY:22991646	G G	GA GA	1	a0001c0001t0001g0011 a0001c0001t0001g0011	1	HG01952.hp1 HG01952.hp1	intron_variant	MODIFIER	c.-41-654dupA c.-41-654dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991646
chrY:22991686	TA TA	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-615delA c.-41-615delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991686
chrY:22991745	TG TG	T T	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-556delG c.-41-556delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991745
chrY:22991754	T T	TG TG	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-549_-41-548ins others(1): Show c.-41-549_-41-548insG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22991754
chrY:22991755	A A	G G	28	a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0004 others(25): Show a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0004 a0001c0001t0001g0005 a0001c0001t0001g0006 a0001c0001t0001g0007 a0001c0001t0001g0010 a0001c0001t0001g0011 a0001c0001t0001g0012 a0001c0001t0001g0013 a0001c0001t0001g0016 a0001c0001t0001g0017 a0001c0001t0001g0018 a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0021 a0001c0001t0001g0022 a0001c0001t0001g0023 a0001c0001t0001g0024 a0001c0001t0001g0026 a0001c0001t0001g0027 a0001c0001t0001g0028 a0001c0001t0001g0029 a0001c0001t0001g0030 a0001c0001t0002g0009 a0002c0003t0001g0014 a0003c0002t0003g0031 a0004c0004t0001g0008	43	HG00280.hp1 HG00609.hp1 HG00621.hp1 others(40): Show HG00280.hp1 HG00609.hp1 HG00621.hp1 HG00673.hp1 HG01074.hp1 HG01099.hp1 HG01106.hp1 HG01192.hp1 HG01433.hp1 HG01515.hp1 HG01928.hp1 HG01952.hp1 HG02015.hp2 HG02027.hp1 HG02040.hp1 HG02056.hp1 HG02071.hp1 HG02074.hp1 HG02083.hp1 HG02132.hp1 HG02602.hp1 HG02698.hp1 HG02735.hp1 HG02738.hp1 HG03017.hp1 HG03098.hp1 HG03490.hp1 HG03492.hp1 HG03579.hp1 HG04115.hp1 HG04204.hp1 HG04228.hp1 NA18747.hp1 NA18962.hp1 NA18971.hp1 NA18974.hp1 NA18977.hp1 NA18989.hp1 NA18994.hp1 NA19007.hp1 NA19009.hp1 NA20805.hp1 NA20905.hp1	intron_variant	MODIFIER	c.-41-548A>G c.-41-548A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22991755
chrY:22991769	AG AG	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-532delG c.-41-532delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991769
chrY:22991801	T T	TA TA	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-501dupA c.-41-501dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991801
chrY:22991806	G G	GC GC	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-497_-41-496ins others(1): Show c.-41-497_-41-496insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22991806
chrY:22991817	A A	AG AG	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-486_-41-485ins others(1): Show c.-41-486_-41-485insG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22991817
chrY:22991831	C C	CA CA	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-472_-41-471ins others(1): Show c.-41-472_-41-471insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22991831
chrY:22991907	C C	CT CT	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-390dupT c.-41-390dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991907
chrY:22991993	G G	GC GC	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-308dupC c.-41-308dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991993
chrY:22991997	G G	GT GT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-305dupT c.-41-305dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22991997
chrY:22992006	CCG CCG	C C	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-295_-41-294del others(2): Show c.-41-295_-41-294delGC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992006
chrY:22992009	C C	G G	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-294C>G c.-41-294C>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22992009
chrY:22992026	T T	TG TG	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-276dupG c.-41-276dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992026
chrY:22992051	AG AG	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-249delG c.-41-249delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992051
chrY:22992059	TC TC	T T	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-240delC c.-41-240delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992059
chrY:22992064	T T	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-239T>A c.-41-239T>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22992064
chrY:22992089	A A	AT AT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-212dupT c.-41-212dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992089
chrY:22992114	GC GC	G G	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-187delC c.-41-187delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992114
chrY:22992158	A A	AG AG	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.-41-139dupG c.-41-139dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992158
chrY:22992177	A A	AT AT	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-126_-41-125ins others(1): Show c.-41-126_-41-125insT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8		chrY	22992177
chrY:22992203	ACT ACT	A A	1	a0001c0001t0001g0025 a0001c0001t0001g0025	1	NA19060.hp1 NA19060.hp1	intron_variant	MODIFIER	c.-41-97_-41-96delCT c.-41-97_-41-96delCT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992203
chrY:22992218	TC TC	T T	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.-41-83delC c.-41-83delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992218
chrY:22992248	A A	AC AC	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.-41-54dupC c.-41-54dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	3/8	INFO_REALIGN_3_PRIME	chrY	22992248
chrY:22992464	TA TA	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.78+45delA c.78+45delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992464
chrY:22992485	G G	GC GC	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.78+67dupC c.78+67dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992485
chrY:22992510	AC AC	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.78+91delC c.78+91delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992510
chrY:22992555	G G	GT GT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+136dupT c.78+136dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992555
chrY:22992626	A A	AC AC	2	a0001c0001t0001g0030 a0003c0002t0003g0031 a0001c0001t0001g0030 a0003c0002t0003g0031	2	NA18989.hp1 NA18994.hp1 NA18989.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+208dupC c.78+208dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992626
chrY:22992684	CT CT	C C	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.78+265delT c.78+265delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992684
chrY:22992702	AG AG	A A	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.78+288delG c.78+288delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992702
chrY:22992711	T T	TA TA	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+290_78+291insA c.78+290_78+291insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22992711
chrY:22992729	G G	GC GC	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.78+311dupC c.78+311dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992729
chrY:22992743	T T	TG TG	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+323dupG c.78+323dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992743
chrY:22992807	C C	CT CT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+387dupT c.78+387dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992807
chrY:22992840	G G	GC GC	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.78+422dupC c.78+422dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992840
chrY:22992867	AT AT	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+449delT c.78+449delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992867
chrY:22992951	T T	TA TA	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.78+534dupA c.78+534dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992951
chrY:22992982	AC AC	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+564delC c.78+564delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992982
chrY:22992989	C C	CA CA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+570dupA c.78+570dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22992989
chrY:22993004	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+584dupG c.78+584dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993004
chrY:22993012	A A	AT AT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+592dupT c.78+592dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993012
chrY:22993076	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+655_78+656insG c.78+655_78+656insG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993076
chrY:22993078	A A	AC AC	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+658dupC c.78+658dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993078
chrY:22993093	AT AT	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+676delT c.78+676delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993093
chrY:22993129	T T	TA TA	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.78+710dupA c.78+710dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993129
chrY:22993150	G G	GA GA	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+733dupA c.78+733dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993150
chrY:22993156	TG TG	T T	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.78+738delG c.78+738delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993156
chrY:22993160	A A	AT AT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+741dupT c.78+741dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993160
chrY:22993236	AT AT	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+816delT c.78+816delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993236
chrY:22993300	T T	TC TC	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+880dupC c.78+880dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993300
chrY:22993318	G G	A A	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.78+897G>A c.78+897G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993318
chrY:22993336	T T	TC TC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.78+915_78+916insC c.78+915_78+916insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993336
chrY:22993345	G G	GC GC	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+926dupC c.78+926dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993345
chrY:22993407	TG TG	T T	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.78+989delG c.78+989delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993407
chrY:22993527	A A	AT AT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-953dupT c.79-953dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993527
chrY:22993566	C C	CA CA	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-911dupA c.79-911dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993566
chrY:22993606	G G	GA GA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-874dupA c.79-874dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993606
chrY:22993631	C C	CA CA	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.79-844dupA c.79-844dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993631
chrY:22993665	C C	CG CG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-815dupG c.79-815dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993665
chrY:22993697	T T	TA TA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-784_79-783insA c.79-784_79-783insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993697
chrY:22993730	A A	AG AG	2	a0001c0001t0001g0030 a0003c0002t0003g0031 a0001c0001t0001g0030 a0003c0002t0003g0031	2	NA18989.hp1 NA18994.hp1 NA18989.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-749dupG c.79-749dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993730
chrY:22993751	CT CT	C C	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-726delT c.79-726delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993751
chrY:22993772	CA CA	C C	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-704delA c.79-704delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993772
chrY:22993777	A A	T T	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.79-704A>T c.79-704A>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993777
chrY:22993783	T T	G G	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-698T>G c.79-698T>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22993783
chrY:22993796	T T	TG TG	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-683dupG c.79-683dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993796
chrY:22993841	A A	AC AC	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-639dupC c.79-639dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993841
chrY:22993897	G G	GC GC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-582dupC c.79-582dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993897
chrY:22993987	T T	TA TA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-491dupA c.79-491dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22993987
chrY:22994031	C C	CT CT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-448dupT c.79-448dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994031
chrY:22994045	AC AC	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-433delC c.79-433delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994045
chrY:22994107	A A	AT AT	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.79-369dupT c.79-369dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994107
chrY:22994107	AT AT	A A	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.79-369delT c.79-369delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994107
chrY:22994187	T T	TA TA	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-292dupA c.79-292dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994187
chrY:22994294	AT AT	A A	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.79-184delT c.79-184delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994294
chrY:22994312	C C	T T	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-169C>T c.79-169C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22994312
chrY:22994313	T T	A A	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-168T>A c.79-168T>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22994313
chrY:22994314	A A	T T	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-167A>T c.79-167A>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22994314
chrY:22994318	A A	T T	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-163A>T c.79-163A>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22994318
chrY:22994323	A A	AC AC	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-157dupC c.79-157dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994323
chrY:22994343	AC AC	A A	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.79-136delC c.79-136delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994343
chrY:22994346	G G	GC GC	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.79-134dupC c.79-134dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994346
chrY:22994360	G G	A A	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.79-121G>A c.79-121G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22994360
chrY:22994411	A A	AT AT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.79-70_79-69insT c.79-70_79-69insT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8		chrY	22994411
chrY:22994418	TC TC	T T	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.79-61delC c.79-61delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	4/8	INFO_REALIGN_3_PRIME	chrY	22994418
chrY:22994616	ATGT ATGT	A A	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+21_196+23delTT others(1): Show c.196+21_196+23delTTG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994616
chrY:22994620	TG TG	T T	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.196+25delG c.196+25delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994620
chrY:22994636	G G	GGA GGA	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+43_196+44dupGA c.196+43_196+44dupGA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994636
chrY:22994666	A A	AG AG	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+70dupG c.196+70dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994666
chrY:22994716	G G	GT GT	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+121dupT c.196+121dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994716
chrY:22994747	TC TC	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+151delC c.196+151delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994747
chrY:22994832	G G	GT GT	1	a0001c0001t0001g0030 a0001c0001t0001g0030	1	NA18994.hp1 NA18994.hp1	intron_variant	MODIFIER	c.196+239dupT c.196+239dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994832
chrY:22994835	T T	TC TC	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+237_196+238ins others(1): Show c.196+237_196+238insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22994835
chrY:22994858	C C	CA CA	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+260_196+261ins others(1): Show c.196+260_196+261insA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22994858
chrY:22994871	TC TC	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+275delC c.196+275delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994871
chrY:22994897	A A	AG AG	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+299_196+300ins others(1): Show c.196+299_196+300insG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22994897
chrY:22994907	T T	TG TG	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+310dupG c.196+310dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994907
chrY:22994918	TA TA	T T	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.196+323delA c.196+323delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994918
chrY:22994952	AT AT	A A	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.196+359delT c.196+359delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22994952
chrY:22995032	TG TG	T T	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18977.hp1 NA18977.hp1	intron_variant	MODIFIER	c.196+437delG c.196+437delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995032
chrY:22995200	AT AT	A A	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.196+605delT c.196+605delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995200
chrY:22995221	A A	T T	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+623A>T c.196+623A>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22995221
chrY:22995247	T T	TG TG	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+650dupG c.196+650dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995247
chrY:22995277	G G	GT GT	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+682dupT c.196+682dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995277
chrY:22995293	AT AT	A A	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.196+697delT c.196+697delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995293
chrY:22995296	A A	AG AG	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+701dupG c.196+701dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995296
chrY:22995327	C C	CA CA	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+733dupA c.196+733dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995327
chrY:22995353	G G	GC GC	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+758dupC c.196+758dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995353
chrY:22995397	G G	GC GC	1	a0001c0001t0001g0026 a0001c0001t0001g0026	1	HG02071.hp1 HG02071.hp1	intron_variant	MODIFIER	c.196+800dupC c.196+800dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995397
chrY:22995429	GC GC	G G	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.196+834delC c.196+834delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995429
chrY:22995663	TG TG	T T	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.196+1069delG c.196+1069delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995663
chrY:22995845	A A	AG AG	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.196+1250dupG c.196+1250dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995845
chrY:22995845	AG AG	A A	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.196+1250delG c.196+1250delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995845
chrY:22995889	A A	AT AT	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.196+1293dupT c.196+1293dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995889
chrY:22995934	C C	CT CT	3	a0001c0001t0001g0010 a0001c0001t0001g0025 a0001c0001t0001g0026 a0001c0001t0001g0010 a0001c0001t0001g0025 a0001c0001t0001g0026	3	HG02071.hp1 HG02698.hp1 NA19060.hp1 HG02071.hp1 HG02698.hp1 NA19060.hp1	intron_variant	MODIFIER	c.196+1348dupT c.196+1348dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995934
chrY:22995934	CT CT	C C	3	a0001c0001t0001g0017 a0001c0001t0002g0009 a0002c0003t0001g0014 a0001c0001t0001g0017 a0001c0001t0002g0009 a0002c0003t0001g0014	3	HG02040.hp1 HG02735.hp1 NA19007.hp1 HG02040.hp1 HG02735.hp1 NA19007.hp1	intron_variant	MODIFIER	c.196+1348delT c.196+1348delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22995934
chrY:22995991	GGC GGC	G G	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.196+1394_196+1395d others(4): Show c.196+1394_196+1395delGC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22995991
chrY:22996171	G G	GT GT	4	a0001c0001t0001g0007 a0001c0001t0001g0024 a0001c0001t0001g0027 others(1): Show a0001c0001t0001g0007 a0001c0001t0001g0024 a0001c0001t0001g0027 a0004c0004t0001g0008	4	HG00609.hp1 HG00621.hp1 HG02056.hp1 others(1): Show HG00609.hp1 HG00621.hp1 HG02056.hp1 NA19009.hp1	intron_variant	MODIFIER	c.197-1262dupT c.197-1262dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996171
chrY:22996171	G G	GTT GTT	1	a0003c0002t0003g0031 a0003c0002t0003g0031	1	NA18989.hp1 NA18989.hp1	intron_variant	MODIFIER	c.197-1263_197-1262d others(4): Show c.197-1263_197-1262dupTT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996171
chrY:22996171	GT GT	G G	2	a0001c0001t0001g0017 a0001c0001t0001g0018 a0001c0001t0001g0017 a0001c0001t0001g0018	2	HG00673.hp1 NA19007.hp1 HG00673.hp1 NA19007.hp1	intron_variant	MODIFIER	c.197-1262delT c.197-1262delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996171
chrY:22996226	G G	GT GT	1	a0004c0004t0001g0008 a0004c0004t0001g0008	1	NA19009.hp1 NA19009.hp1	intron_variant	MODIFIER	c.197-1223dupT c.197-1223dupT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996226
chrY:22996346	CT CT	C C	2	a0001c0001t0001g0016 a0001c0001t0002g0009 a0001c0001t0001g0016 a0001c0001t0002g0009	2	HG01074.hp1 HG02735.hp1 HG01074.hp1 HG02735.hp1	intron_variant	MODIFIER	c.197-1099delT c.197-1099delT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996346
chrY:22996363	T T	TG TG	1	a0001c0001t0001g0023 a0001c0001t0001g0023	1	HG01433.hp1 HG01433.hp1	intron_variant	MODIFIER	c.197-1086dupG c.197-1086dupG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996363
chrY:22996446	C C	T T	2	a0001c0001t0001g0016 a0001c0001t0001g0022 a0001c0001t0001g0016 a0001c0001t0001g0022	2	HG01074.hp1 HG01106.hp1 HG01074.hp1 HG01106.hp1	intron_variant	MODIFIER	c.197-1006C>T c.197-1006C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22996446
chrY:22996448	AG AG	A A	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.197-1002delG c.197-1002delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996448
chrY:22996546	TAG TAG	T T	1	a0001c0001t0001g0012 a0001c0001t0001g0012	1	HG02015.hp2 HG02015.hp2	intron_variant	MODIFIER	c.197-901_197-900del others(2): Show c.197-901_197-900delAG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996546
chrY:22996647	GC GC	G G	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.197-803delC c.197-803delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996647
chrY:22996709	G G	A A	1	a0001c0001t0001g0019 a0001c0001t0001g0019	1	HG00280.hp1 HG00280.hp1	intron_variant	MODIFIER	c.197-743G>A c.197-743G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8		chrY	22996709
chrY:22996752	TC TC	T T	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.197-698delC c.197-698delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996752
chrY:22996916	GA GA	G G	1	a0001c0001t0001g0016 a0001c0001t0001g0016	1	HG01074.hp1 HG01074.hp1	intron_variant	MODIFIER	c.197-532delA c.197-532delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22996916
chrY:22997080	TC TC	T T	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.197-370delC c.197-370delC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22997080
chrY:22997295	C C	CA CA	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.197-156dupA c.197-156dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	5/8	INFO_REALIGN_3_PRIME	chrY	22997295
chrY:22997632	CA CA	C C	1	a0001c0001t0002g0009 a0001c0001t0002g0009	1	HG02735.hp1 HG02735.hp1	intron_variant	MODIFIER	c.302+80delA c.302+80delA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/8	INFO_REALIGN_3_PRIME	chrY	22997632
chrY:22997651	TG TG	T T	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.302+97delG c.302+97delG	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/8	INFO_REALIGN_3_PRIME	chrY	22997651
chrY:22997883	T T	TC TC	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.302+327dupC c.302+327dupC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/8	INFO_REALIGN_3_PRIME	chrY	22997883
chrY:22997893	A A	AC AC	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.302+336_302+337ins others(1): Show c.302+336_302+337insC	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/8		chrY	22997893
chrY:22998023	T T	G G	1	a0001c0001t0001g0020 a0001c0001t0001g0020	1	NA18747.hp1 NA18747.hp1	intron_variant	MODIFIER	c.303-227T>G c.303-227T>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/8		chrY	22998023
chrY:22998091	G G	GA GA	1	a0002c0003t0001g0014 a0002c0003t0001g0014	1	HG02040.hp1 HG02040.hp1	intron_variant	MODIFIER	c.303-158dupA c.303-158dupA	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	6/8	INFO_REALIGN_3_PRIME	chrY	22998091
chrY:22998928	G G	A A	2	a0001c0001t0001g0021 a0002c0003t0001g0014 a0001c0001t0001g0021 a0002c0003t0001g0014	2	HG01928.hp1 HG02040.hp1 HG01928.hp1 HG02040.hp1	intron_variant	MODIFIER	c.106+554G>A c.106+554G>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	22998928
chrY:23000507	A A	G G	26	a0001c0001t0001g0003 a0001c0001t0001g0004 a0001c0001t0001g0005 others(23): Show a0001c0001t0001g0003 a0001c0001t0001g0004 a0001c0001t0001g0005 a0001c0001t0001g0006 a0001c0001t0001g0007 a0001c0001t0001g0011 a0001c0001t0001g0012 a0001c0001t0001g0013 a0001c0001t0001g0016 a0001c0001t0001g0017 a0001c0001t0001g0018 a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0021 a0001c0001t0001g0022 a0001c0001t0001g0023 a0001c0001t0001g0024 a0001c0001t0001g0025 a0001c0001t0001g0026 a0001c0001t0001g0027 a0001c0001t0001g0028 a0001c0001t0001g0030 a0001c0001t0002g0009 a0002c0003t0001g0014 a0003c0002t0003g0031 a0004c0004t0001g0008	33	HG00280.hp1 HG00609.hp1 HG00621.hp1 others(30): Show HG00280.hp1 HG00609.hp1 HG00621.hp1 HG00673.hp1 HG01074.hp1 HG01099.hp1 HG01106.hp1 HG01192.hp1 HG01433.hp1 HG01928.hp1 HG01952.hp1 HG02015.hp2 HG02027.hp1 HG02040.hp1 HG02056.hp1 HG02071.hp1 HG02074.hp1 HG02083.hp1 HG02735.hp1 HG03098.hp1 HG03579.hp1 NA18747.hp1 NA18962.hp1 NA18971.hp1 NA18974.hp1 NA18977.hp1 NA18989.hp1 NA18994.hp1 NA19007.hp1 NA19009.hp1 NA19060.hp1 NA20805.hp1 NA20905.hp1	intron_variant	MODIFIER	c.106+2133A>G c.106+2133A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23000507
chrY:23001820	A A	C C	1	a0001c0001t0001g0012 a0001c0001t0001g0012	1	HG02015.hp2 HG02015.hp2	intron_variant	MODIFIER	c.107-3105A>C c.107-3105A>C	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23001820
chrY:23002926	C C	T T	1	a0001c0001t0001g0022 a0001c0001t0001g0022	1	HG01106.hp1 HG01106.hp1	intron_variant	MODIFIER	c.107-1999C>T c.107-1999C>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23002926
chrY:23004017	A A	ACT ACT	2	a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0019 a0001c0001t0001g0020	2	HG00280.hp1 NA18747.hp1 HG00280.hp1 NA18747.hp1	intron_variant	MODIFIER	c.107-908_107-907i others(4): Show c.107-908_107-907insCT	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004017
chrY:23004018	T T	G G	2	a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0019 a0001c0001t0001g0020	2	HG00280.hp1 NA18747.hp1 HG00280.hp1 NA18747.hp1	intron_variant	MODIFIER	c.107-907T>G c.107-907T>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004018
chrY:23004020	T T	A A	2	a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0019 a0001c0001t0001g0020	2	HG00280.hp1 NA18747.hp1 HG00280.hp1 NA18747.hp1	intron_variant	MODIFIER	c.107-905T>A c.107-905T>A	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004020
chrY:23004021	A A	G G	2	a0001c0001t0001g0019 a0001c0001t0001g0020 a0001c0001t0001g0019 a0001c0001t0001g0020	2	HG00280.hp1 NA18747.hp1 HG00280.hp1 NA18747.hp1	intron_variant	MODIFIER	c.107-904A>G c.107-904A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004021
chrY:23004289	A A	G G	1	a0001c0001t0001g0010 a0001c0001t0001g0010	1	HG02698.hp1 HG02698.hp1	intron_variant	MODIFIER	c.107-636A>G c.107-636A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004289
chrY:23004575	A A	T T	1	a0001c0001t0001g0023 a0001c0001t0001g0023	1	HG01433.hp1 HG01433.hp1	intron_variant	MODIFIER	c.107-350A>T c.107-350A>T	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004575
chrY:23004577	A A	G G	4	a0001c0001t0001g0011 a0001c0001t0001g0016 a0001c0001t0001g0022 others(1): Show a0001c0001t0001g0011 a0001c0001t0001g0016 a0001c0001t0001g0022 a0001c0001t0002g0009	4	HG01074.hp1 HG01106.hp1 HG01952.hp1 others(1): Show HG01074.hp1 HG01106.hp1 HG01952.hp1 HG02735.hp1	intron_variant	MODIFIER	c.107-348A>G c.107-348A>G	BPY2	ENSG00000183753.10	transcript	ENST00000331070.8	protein_coding	7/8		chrY	23004577

Search by Genic region

Search

JoGo Haplotype Explorer

BPY2_chrY_22979263_23010465 Genic Haplotype Structure on iGV

Translation Multiple Alignment View

Gene Summary (with MANE)

Amino acid(protein) Level Haplotype Info (Total: 4)

Coding Level Haplotype Info (Total: 4)

Transcript Level Haplotype Info (Total: 5)

Genebody Level Haplotype Info (Total: 31)

Haplotype Details by Sample (Haploid Level) (Total: 52)

Amino acid(protein) Level Haplotype Related Variants (Effect to Protein Coding Variants) (Total: 4)

Coding Level Variants (On coding region but no effect to protein coding variants: Synonymous Mutations) (Total: 0)

Transcript Level Haplotype Variants (Exon) (Total: 2)

Genebody Level Haplotype Variants (Intron) (Total: 271)

Annotation (Repeats)

Annotation (SNP Array)