Joint Open Genome and Omics Platform (JoGo)

Search by Genic region

Item	Value
geneid	1527
ensemblid	ENSG00000278057.4
hgncid	2563
symbol	TEX28
name	testis expressed 28
refseq_nuc	NM_001586.3
refseq_prot	NP_001577.1
ensembl_nuc	ENST00000617225.5
ensembl_prot	ENSP00000482010.1
mane_status	MANE Select
chr	chrX
start	154271265
end	154295124
strand	-
ver	v1.2
region	chrX:154271265-154295124
region5000	chrX:154266265-154300124
regionname0	TEX28_chrX_154271265_154295124
regionname5000	TEX28_chrX_154266265_154300124

ahapid	grch38/ chm13v2	alen	total	AFR	AMR	EAS	EUR	SAS	JPT	regionname	genename	aa	chr	start	end
a0001	1/1	410	15	2	1	8	0	2	8	TEX28_chrX_154266265_154300124	TEX28	MVLKA others(405): Show MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDS VRHRILYLSEQLRVEKASRDGNTVSYLKLVSKADRHQVPHIQQAFEKVNQ RASATIAQIEHRLHQCHQQLQELEEGCRPEGLLLMAESDPANCEPPSEKA LLSEPPEPGGEDGPVNLPHASRPFILESRFQSLQQGTCLETEDVAQQQNL LLQKVKAELEEAKRFHISLQESYHSLKERSLTDLQLLLESLQEEKCRQAL MEEQVNGRLQGQLNEIYNLKHNLACSEERMAYLSYERAKEIWEITETFKS RISKLEMLQQVTQLEAAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLC ACPSSLISSRLCTCTMLMLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYS KDSGPPADGP	chrX	154266265	154300124

achapid	grch38/ chm13v2	alen	clen	total	AFR	AMR	EAS	EUR	SAS	regionname	genename	aseq	cseq	chr	start	end
a0001c0001	1/1		1230	15	2	1	8	0	2	TEX28_chrX_154266265_154300124	TEX28		ATGGT others(1225): Show ATGGTTTTAAAGGCGGAACACACCAGGAGCCCCAGCGCAACCCTCCCCTC CAATGTGCCTTCATGCCGGTCCCTGTCATCCAGCGAAGACGGCCCCAGTG GCCCTTCCAGCCTCGCAGATGGAGGCCTAGCCCACAACTTACAGGATAGT GTCAGGCACCGCATCCTCTACCTCTCAGAGCAGCTGAGAGTGGAGAAGGC CAGTCGGGATGGCAACACTGTGAGCTACCTCAAGCTGGTATCCAAAGCAG ACCGGCACCAGGTGCCGCACATCCAGCAGGCCTTTGAGAAGGTGAACCAG CGCGCCTCTGCCACCATCGCCCAGATCGAGCACAGGCTCCACCAGTGTCA CCAGCAGCTCCAGGAGCTGGAGGAAGGCTGCAGGCCCGAGGGCTTACTGC TGATGGCAGAAAGCGACCCAGCCAACTGCGAGCCACCCAGTGAGAAGGCC CTGCTTTCAGAGCCCCCCGAGCCAGGTGGGGAAGACGGGCCGGTCAACCT GCCTCATGCCAGCAGGCCCTTCATCTTGGAGAGTCGCTTCCAGAGCTTAC AGCAGGGGACGTGCTTAGAGACAGAGGATGTGGCCCAGCAACAAAACCTG CTGTTGCAGAAGGTAAAGGCAGAGCTGGAAGAAGCCAAGAGGTTCCACAT CAGCCTCCAGGAGTCCTATCACAGCCTAAAGGAGAGGTCTCTGACTGACC TGCAGCTGTTGCTGGAGTCCCTTCAGGAGGAGAAGTGTAGGCAAGCATTG ATGGAAGAACAGGTGAATGGTCGCCTGCAGGGACAGCTGAATGAGATTTA CAACCTCAAACACAATCTGGCCTGCAGCGAAGAGAGAATGGCCTATCTAT CCTATGAGAGAGCCAAGGAAATATGGGAGATCACGGAGACCTTCAAGAGC CGAATATCCAAGCTGGAGATGCTACAGCAAGTCACCCAACTGGAGGCAGC GGAGCACCTCCAAAGCCGTCCCCCGCAGATGTTGTTCAAGTTCCTGAGTC CGCGCCTCTCACTGGCAACCGTCCTCTTGGTCTTTGTCTCCACCTTGTGT GCCTGCCCCTCGTCACTGATCAGCTCACGCCTGTGCACCTGCACCATGCT GATGCTGATCGGGCTTGGGGTCCTGGCCTGGCAGAGGTGGCGCGCCATCC CTGCCACAGACTGGCAGGAATGGGTCCCCTCCAGGTGTAGACTGTACTCC AAGGACTCTGGGCCTCCAGCAGATGGACCT	chrX	154266265	154300124

acthapid	grch38 chm13v2	tlen	total	AFR	AMR	EAS	EUR	SAS	regionname	genename	tseq	chr	start	end
a0001c0001t0001	1/1	1566	15	2	1	8	0	2	TEX28_chrX_154266265_154300124	TEX28	GAATG others(1561): Show GAATGTGCTCGCCCTGTGTCTGAAATGCCCCATGTCCGGTGGTGCCAGCA CTAGCCCCCATGTCGGTCTCAGAGAACCTTCTCCCCACCTCTGAGTTATT CTCTCAGTGTATCGAAGATATCAGTCAACTATCTTCTGGATTGCATTGAT GCTATTGAGAAGGCAGCCTGCAGTCTAAAAGTCATGGTTTTAAAGGCGGA ACACACCAGGAGCCCCAGCGCAACCCTCCCCTCCAATGTGCCTTCATGCC GGTCCCTGTCATCCAGCGAAGACGGCCCCAGTGGCCCTTCCAGCCTCGCA GATGGAGGCCTAGCCCACAACTTACAGGATAGTGTCAGGCACCGCATCCT CTACCTCTCAGAGCAGCTGAGAGTGGAGAAGGCCAGTCGGGATGGCAACA CTGTGAGCTACCTCAAGCTGGTATCCAAAGCAGACCGGCACCAGGTGCCG CACATCCAGCAGGCCTTTGAGAAGGTGAACCAGCGCGCCTCTGCCACCAT CGCCCAGATCGAGCACAGGCTCCACCAGTGTCACCAGCAGCTCCAGGAGC TGGAGGAAGGCTGCAGGCCCGAGGGCTTACTGCTGATGGCAGAAAGCGAC CCAGCCAACTGCGAGCCACCCAGTGAGAAGGCCCTGCTTTCAGAGCCCCC CGAGCCAGGTGGGGAAGACGGGCCGGTCAACCTGCCTCATGCCAGCAGGC CCTTCATCTTGGAGAGTCGCTTCCAGAGCTTACAGCAGGGGACGTGCTTA GAGACAGAGGATGTGGCCCAGCAACAAAACCTGCTGTTGCAGAAGGTAAA GGCAGAGCTGGAAGAAGCCAAGAGGTTCCACATCAGCCTCCAGGAGTCCT ATCACAGCCTAAAGGAGAGGTCTCTGACTGACCTGCAGCTGTTGCTGGAG TCCCTTCAGGAGGAGAAGTGTAGGCAAGCATTGATGGAAGAACAGGTGAA TGGTCGCCTGCAGGGACAGCTGAATGAGATTTACAACCTCAAACACAATC TGGCCTGCAGCGAAGAGAGAATGGCCTATCTATCCTATGAGAGAGCCAAG GAAATATGGGAGATCACGGAGACCTTCAAGAGCCGAATATCCAAGCTGGA GATGCTACAGCAAGTCACCCAACTGGAGGCAGCGGAGCACCTCCAAAGCC GTCCCCCGCAGATGTTGTTCAAGTTCCTGAGTCCGCGCCTCTCACTGGCA ACCGTCCTCTTGGTCTTTGTCTCCACCTTGTGTGCCTGCCCCTCGTCACT GATCAGCTCACGCCTGTGCACCTGCACCATGCTGATGCTGATCGGGCTTG GGGTCCTGGCCTGGCAGAGGTGGCGCGCCATCCCTGCCACAGACTGGCAG GAATGGGTCCCCTCCAGGTGTAGACTGTACTCCAAGGACTCTGGGCCTCC AGCAGATGGACCTTAAGGGGCCAGGAGGGCCACCTGCCTTAGCTTGCTAG CTCCCTCCCTCCTCCTGGGTGCTGAGGGCATCCAGCAAGCCCCTCCACAG CTCTTGCTTGCCGATTATGTAACCACCAGCCTGGTGAAATGGATATAGAC GCCCACCTGCCTCACA	chrX	154266265	154300124

actghapid	grch38/ chm13v2	total	AFR	AMR	EAS	SAS	regionname	genename	chr	start	end
a0001c0001t0001g0001	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0002	0/1	1	0	0	0	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0003	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0004	0/0	1	0	0	0	1	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0005	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0006	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0007	0/0	1	0	0	0	1	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0008	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0009	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0010	1/0	1	0	0	0	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0011	0/0	1	0	1	0	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0012	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0013	0/0	1	0	0	1	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0014	0/0	1	1	0	0	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
a0001c0001t0001g0015	0/0	1	1	0	0	0	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124

sampleid	ID haplotypeid	ahapid	chapid	thapid	ghapid	gpopname	popname	regionname	genename	chr	start	end
HG01255	hp1	a0001	c0001	t0001	g0011	AMR	CLM	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
HG02145	hp1	a0001	c0001	t0001	g0014	AFR	ACB	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
HG02965	hp1	a0001	c0001	t0001	g0015	AFR	ESN	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
HG04199	hp1	a0001	c0001	t0001	g0007	SAS	STU	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
HG04228	hp1	a0001	c0001	t0001	g0004	SAS	STU	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA18953	hp1	a0001	c0001	t0001	g0008	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA18967	hp1	a0001	c0001	t0001	g0013	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA18970	hp2	a0001	c0001	t0001	g0012	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA19012	hp1	a0001	c0001	t0001	g0006	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA19068	hp1	a0001	c0001	t0001	g0005	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA19075	hp1	a0001	c0001	t0001	g0009	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA19085	hp1	a0001	c0001	t0001	g0003	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
NA19088	hp1	a0001	c0001	t0001	g0001	EAS	JPT	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
homoSapiens	chm13v2	a0001	c0001	t0001	g0002	REF	REF	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124
homoSapiens	grch38p0	a0001	c0001	t0001	g0010	REF	REF	TEX28_chrX_154266265_154300124	TEX28	chrX	154266265	154300124

view	chr:pos	ref	alt	# # of ahapid:amino-acid(protein) level	ahapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	hgvs_p	genename	geneid	featuretype	featureid	transcript_biotype	rank	cdna cdna pos length	cds cds pos length	aa aa pos length	distance	status	chr	pos

view	chr:pos	ref	alt	# # of chapid	chapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	hgvs_p	genename	geneid	featuretype	featureid	transcript_biotype	rank	cdna cdna pos length	cds cds pos length	aa aa pos length	distance	status	chr	pos

view	chr:pos	ref	alt	# # of thapid:transcript level	thapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	hgvs_p	genename	geneid	featuretype	featureid	transcript_biotype	rank	cdna cdna pos length	cds cds pos length	aa aa pos length	distance	status	chr	pos

chr:pos	ref	alt	# # of ghapid:genebody level	ghapids	# # of haplotypeids	haplotypeids	annotation	impact	hgvs_c	genename	geneid	featuretype	featureid	genebody_biotype	rank	chr	pos
chrX:154272846	TC TC	T T	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-321delG c.741-321delG	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154272846
chrX:154273233	C C	CA CA	5	a0001c0001t0001g0005 a0001c0001t0001g0011 a0001c0001t0001g0013 others(2): Show a0001c0001t0001g0005 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	5	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(2): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 NA18967.hp1 NA19068.hp1	intron_variant	MODIFIER	c.741-708dupT c.741-708dupT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154273233
chrX:154273291	G G	T T	5	a0001c0001t0001g0005 a0001c0001t0001g0011 a0001c0001t0001g0013 others(2): Show a0001c0001t0001g0005 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	5	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(2): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 NA18967.hp1 NA19068.hp1	intron_variant	MODIFIER	c.741-765C>A c.741-765C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154273291
chrX:154273356	A A	G G	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-830T>C c.741-830T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154273356
chrX:154273761	C C	G G	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-1235G>C c.741-1235G>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154273761
chrX:154273834	T T	C C	6	a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0011 others(3): Show a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	6	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(3): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18967.hp1 NA19068.hp1	intron_variant	MODIFIER	c.741-1308A>G c.741-1308A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154273834
chrX:154274185	C C	A A	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-1659G>T c.741-1659G>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154274185
chrX:154274910	C C	A A	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18967.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-2384G>T c.741-2384G>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154274910
chrX:154275056	G G	A A	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18967.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-2530C>T c.741-2530C>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154275056
chrX:154275239	A A	G G	2	a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0013 a0001c0001t0001g0014	2	HG02145.hp1 NA18967.hp1 HG02145.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-2713T>C c.741-2713T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154275239
chrX:154275505	A A	G G	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18967.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-2979T>C c.741-2979T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154275505
chrX:154275928	A A	C C	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18967.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-3402T>G c.741-3402T>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154275928
chrX:154276313	A A	G G	3	a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	3	HG02145.hp1 HG02965.hp1 NA18967.hp1 HG02145.hp1 HG02965.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-3787T>C c.741-3787T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154276313
chrX:154276340	A A	G G	2	a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0013 a0001c0001t0001g0014	2	HG02145.hp1 NA18967.hp1 HG02145.hp1 NA18967.hp1	intron_variant	MODIFIER	c.741-3814T>C c.741-3814T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154276340
chrX:154276396	C C	T T	2	a0001c0001t0001g0006 a0001c0001t0001g0009 a0001c0001t0001g0006 a0001c0001t0001g0009	2	NA19012.hp1 NA19075.hp1 NA19012.hp1 NA19075.hp1	intron_variant	MODIFIER	c.741-3870G>A c.741-3870G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154276396
chrX:154276537	C C	CA CA	3	a0001c0001t0001g0005 a0001c0001t0001g0008 a0001c0001t0001g0012 a0001c0001t0001g0005 a0001c0001t0001g0008 a0001c0001t0001g0012	3	NA18953.hp1 NA18970.hp2 NA19068.hp1 NA18953.hp1 NA18970.hp2 NA19068.hp1	intron_variant	MODIFIER	c.741-4012dupT c.741-4012dupT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154276537
chrX:154276932	G G	A A	1	a0001c0001t0001g0005 a0001c0001t0001g0005	1	NA19068.hp1 NA19068.hp1	intron_variant	MODIFIER	c.741-4406C>T c.741-4406C>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154276932
chrX:154277318	C C	T T	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-4792G>A c.741-4792G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277318
chrX:154277722	C C	T T	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-5196G>A c.741-5196G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277722
chrX:154277724	T T	C C	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-5198A>G c.741-5198A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277724
chrX:154277726	T T	C C	2	a0001c0001t0001g0004 a0001c0001t0001g0014 a0001c0001t0001g0004 a0001c0001t0001g0014	2	HG02145.hp1 HG04228.hp1 HG02145.hp1 HG04228.hp1	intron_variant	MODIFIER	c.741-5200A>G c.741-5200A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277726
chrX:154277728	C C	T T	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-5202G>A c.741-5202G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277728
chrX:154277730	TTC TTC	T T	4	a0001c0001t0001g0003 a0001c0001t0001g0006 a0001c0001t0001g0009 others(1): Show a0001c0001t0001g0003 a0001c0001t0001g0006 a0001c0001t0001g0009 a0001c0001t0001g0011	4	HG01255.hp1 NA19012.hp1 NA19075.hp1 others(1): Show HG01255.hp1 NA19012.hp1 NA19075.hp1 NA19085.hp1	intron_variant	MODIFIER	c.741-5206_741-5205d others(4): Show c.741-5206_741-5205delGA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277730
chrX:154277732	C C	T T	1	a0001c0001t0001g0004 a0001c0001t0001g0004	1	HG04228.hp1 HG04228.hp1	intron_variant	MODIFIER	c.741-5206G>A c.741-5206G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277732
chrX:154277734	C C	T T	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-5208G>A c.741-5208G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277734
chrX:154277736	C C	T T	1	a0001c0001t0001g0004 a0001c0001t0001g0004	1	HG04228.hp1 HG04228.hp1	intron_variant	MODIFIER	c.741-5210G>A c.741-5210G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277736
chrX:154277767	T T	C C	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-5241A>G c.741-5241A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277767
chrX:154277769	T T	C C	1	a0001c0001t0001g0012 a0001c0001t0001g0012	1	NA18970.hp2 NA18970.hp2	intron_variant	MODIFIER	c.741-5243A>G c.741-5243A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277769
chrX:154277771	T T	C C	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG04199.hp1 HG04199.hp1	intron_variant	MODIFIER	c.741-5245A>G c.741-5245A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277771
chrX:154277773	C C	T T	3	a0001c0001t0001g0007 a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0007 a0001c0001t0001g0014 a0001c0001t0001g0015	3	HG02145.hp1 HG02965.hp1 HG04199.hp1 HG02145.hp1 HG02965.hp1 HG04199.hp1	intron_variant	MODIFIER	c.741-5247G>A c.741-5247G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277773
chrX:154277781	T T	C C	2	a0001c0001t0001g0006 a0001c0001t0001g0009 a0001c0001t0001g0006 a0001c0001t0001g0009	2	NA19012.hp1 NA19075.hp1 NA19012.hp1 NA19075.hp1	intron_variant	MODIFIER	c.741-5255A>G c.741-5255A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277781
chrX:154277830	C C	G G	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-5304G>C c.741-5304G>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154277830
chrX:154278008	C C	T T	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-5482G>A c.741-5482G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154278008
chrX:154278261	C C	T T	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-5735G>A c.741-5735G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154278261
chrX:154278471	G G	C C	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-5945C>G c.741-5945C>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154278471
chrX:154278852	C C	T T	1	a0001c0001t0001g0003 a0001c0001t0001g0003	1	NA19085.hp1 NA19085.hp1	intron_variant	MODIFIER	c.741-6326G>A c.741-6326G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154278852
chrX:154278926	G G	C C	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.741-6400C>G c.741-6400C>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154278926
chrX:154279900	C C	T T	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.741-7374G>A c.741-7374G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154279900
chrX:154280270	T T	C C	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+7410A>G c.740+7410A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154280270
chrX:154280313	G G	C C	1	a0001c0001t0001g0007 a0001c0001t0001g0007	1	HG04199.hp1 HG04199.hp1	intron_variant	MODIFIER	c.740+7367C>G c.740+7367C>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154280313
chrX:154280434	G G	T T	4	a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0014 others(1): Show a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0014 a0001c0001t0001g0015	4	HG02145.hp1 HG02965.hp1 NA19085.hp1 others(1): Show HG02145.hp1 HG02965.hp1 NA19085.hp1 NA19088.hp1	intron_variant	MODIFIER	c.740+7246C>A c.740+7246C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154280434
chrX:154280723	C C	A A	1	a0001c0001t0001g0013 a0001c0001t0001g0013	1	NA18967.hp1 NA18967.hp1	intron_variant	MODIFIER	c.740+6957G>T c.740+6957G>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154280723
chrX:154280958	A A	G G	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+6722T>C c.740+6722T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154280958
chrX:154281239	A A	G G	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+6441T>C c.740+6441T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154281239
chrX:154281647	C C	G G	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+6033G>C c.740+6033G>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154281647
chrX:154282170	C C	T T	1	a0001c0001t0001g0003 a0001c0001t0001g0003	1	NA19085.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+5510G>A c.740+5510G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282170
chrX:154282323	C C	G G	6	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0011 others(3): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	6	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(3): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+5357G>C c.740+5357G>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282323
chrX:154282793	G G	C C	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+4887C>G c.740+4887C>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282793
chrX:154282861	G G	T T	5	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0013 others(2): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	5	HG02145.hp1 HG02965.hp1 HG04199.hp1 others(2): Show HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4819C>A c.740+4819C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282861
chrX:154282888	A A	G G	5	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0013 others(2): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	5	HG02145.hp1 HG02965.hp1 HG04199.hp1 others(2): Show HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4792T>C c.740+4792T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282888
chrX:154282939	G G	C C	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+4741C>G c.740+4741C>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282939
chrX:154282989	A A	C C	4	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 others(1): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013	4	HG04199.hp1 NA18953.hp1 NA18967.hp1 others(1): Show HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4691T>G c.740+4691T>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154282989
chrX:154283210	T T	C C	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+4470A>G c.740+4470A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283210
chrX:154283298	G G	T T	6	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 others(3): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	6	HG02145.hp1 HG02965.hp1 HG04199.hp1 others(3): Show HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4382C>A c.740+4382C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283298
chrX:154283327	GT GT	G G	6	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 others(3): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	6	HG02145.hp1 HG02965.hp1 HG04199.hp1 others(3): Show HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4352delA c.740+4352delA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283327
chrX:154283335	T T	G G	4	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 others(1): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013	4	HG04199.hp1 NA18953.hp1 NA18967.hp1 others(1): Show HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4345A>C c.740+4345A>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283335
chrX:154283579	G G	A A	7	a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 others(4): Show a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	7	HG02145.hp1 HG02965.hp1 HG04199.hp1 others(4): Show HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19068.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+4101C>T c.740+4101C>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283579
chrX:154283727	A A	AAG AAG	6	a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 others(3): Show a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013 a0001c0001t0001g0015	6	HG02965.hp1 HG04199.hp1 NA18953.hp1 others(3): Show HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19068.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+3951_740+3952d others(4): Show c.740+3951_740+3952dupCT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283727
chrX:154283767	G G	GAAGA GAAGA	6	a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 others(3): Show a0001c0001t0001g0003 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	6	HG02145.hp1 HG02965.hp1 HG04199.hp1 others(3): Show HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+3909_740+3912d others(6): Show c.740+3909_740+3912dupTCTT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154283767
chrX:154284153	A A	G G	2	a0001c0001t0001g0014 a0001c0001t0001g0015 a0001c0001t0001g0014 a0001c0001t0001g0015	2	HG02145.hp1 HG02965.hp1 HG02145.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+3527T>C c.740+3527T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154284153
chrX:154284157	A A	G G	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+3523T>C c.740+3523T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154284157
chrX:154284296	C C	T T	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+3384G>A c.740+3384G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154284296
chrX:154284685	C C	T T	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+2995G>A c.740+2995G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154284685
chrX:154285031	C C	CTTTTTTT others(9): Show CTTTTTTTTTTTTTTTT	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+2633_740+2648d others(18): Show c.740+2633_740+2648dupAAAAAAAAAAAAAAAA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154285031
chrX:154285031	C C	CTTTTTTT others(22): Show CTTTTTTTTTTTTTTTTTTTTTTTTTTTTT	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+2648_740+2649i others(31): Show c.740+2648_740+2649insAAAAAAAAAAAAAAAAAAAAAAAAAAAA A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154285031
chrX:154285031	CTT CTT	C C	3	a0001c0001t0001g0005 a0001c0001t0001g0008 a0001c0001t0001g0013 a0001c0001t0001g0005 a0001c0001t0001g0008 a0001c0001t0001g0013	3	NA18953.hp1 NA18967.hp1 NA19068.hp1 NA18953.hp1 NA18967.hp1 NA19068.hp1	intron_variant	MODIFIER	c.740+2647_740+2648d others(4): Show c.740+2647_740+2648delAA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154285031
chrX:154285130	G G	T T	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+2550C>A c.740+2550C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154285130
chrX:154285816	C C	T T	8	a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 others(5): Show a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	8	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(5): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19068.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+1864G>A c.740+1864G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154285816
chrX:154286168	C C	G G	8	a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 others(5): Show a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	8	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(5): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19068.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+1512G>C c.740+1512G>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154286168
chrX:154286190	G G	C C	8	a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 others(5): Show a0001c0001t0001g0003 a0001c0001t0001g0005 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0011 a0001c0001t0001g0013 a0001c0001t0001g0014 a0001c0001t0001g0015	8	HG01255.hp1 HG02145.hp1 HG02965.hp1 others(5): Show HG01255.hp1 HG02145.hp1 HG02965.hp1 HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19068.hp1 NA19085.hp1	intron_variant	MODIFIER	c.740+1490C>G c.740+1490C>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154286190
chrX:154286535	G G	T T	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+1145C>A c.740+1145C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154286535
chrX:154286770	T T	G G	1	a0001c0001t0001g0005 a0001c0001t0001g0005	1	NA19068.hp1 NA19068.hp1	intron_variant	MODIFIER	c.740+910A>C c.740+910A>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154286770
chrX:154286774	C C	CT CT	4	a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0006 others(1): Show a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0006 a0001c0001t0001g0014	4	HG02145.hp1 NA19012.hp1 NA19085.hp1 others(1): Show HG02145.hp1 NA19012.hp1 NA19085.hp1 NA19088.hp1	intron_variant	MODIFIER	c.740+905dupA c.740+905dupA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154286774
chrX:154286774	CT CT	C C	3	a0001c0001t0001g0008 a0001c0001t0001g0012 a0001c0001t0001g0013 a0001c0001t0001g0008 a0001c0001t0001g0012 a0001c0001t0001g0013	3	NA18953.hp1 NA18967.hp1 NA18970.hp2 NA18953.hp1 NA18967.hp1 NA18970.hp2	intron_variant	MODIFIER	c.740+905delA c.740+905delA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154286774
chrX:154287036	C C	A A	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.740+644G>T c.740+644G>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154287036
chrX:154287330	G G	A A	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.740+350C>T c.740+350C>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	3/4	chrX	154287330
chrX:154288940	C C	T T	1	a0001c0001t0001g0003 a0001c0001t0001g0003	1	NA19085.hp1 NA19085.hp1	intron_variant	MODIFIER	c.13-533G>A c.13-533G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154288940
chrX:154289037	C C	T T	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.13-630G>A c.13-630G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154289037
chrX:154289511	T T	G G	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.13-1104A>C c.13-1104A>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154289511
chrX:154290398	C C	CA CA	3	a0001c0001t0001g0007 a0001c0001t0001g0013 a0001c0001t0001g0015 a0001c0001t0001g0007 a0001c0001t0001g0013 a0001c0001t0001g0015	3	HG02965.hp1 HG04199.hp1 NA18967.hp1 HG02965.hp1 HG04199.hp1 NA18967.hp1	intron_variant	MODIFIER	c.12+1707dupT c.12+1707dupT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154290398
chrX:154290522	A A	G G	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.12+1584T>C c.12+1584T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154290522
chrX:154290703	T T	A A	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.12+1403A>T c.12+1403A>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154290703
chrX:154291107	AAGAG AAGAG	A A	4	a0001c0001t0001g0008 a0001c0001t0001g0012 a0001c0001t0001g0013 others(1): Show a0001c0001t0001g0008 a0001c0001t0001g0012 a0001c0001t0001g0013 a0001c0001t0001g0015	4	HG02965.hp1 NA18953.hp1 NA18967.hp1 others(1): Show HG02965.hp1 NA18953.hp1 NA18967.hp1 NA18970.hp2	intron_variant	MODIFIER	c.12+995_12+998delCT others(2): Show c.12+995_12+998delCTCT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154291107
chrX:154291755	A A	AT AT	3	a0001c0001t0001g0006 a0001c0001t0001g0009 a0001c0001t0001g0014 a0001c0001t0001g0006 a0001c0001t0001g0009 a0001c0001t0001g0014	3	HG02145.hp1 NA19012.hp1 NA19075.hp1 HG02145.hp1 NA19012.hp1 NA19075.hp1	intron_variant	MODIFIER	c.12+350dupA c.12+350dupA	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	2/4	chrX	154291755
chrX:154292581	C C	CA CA	4	a0001c0001t0001g0006 a0001c0001t0001g0007 a0001c0001t0001g0008 others(1): Show a0001c0001t0001g0006 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0013	4	HG04199.hp1 NA18953.hp1 NA18967.hp1 others(1): Show HG04199.hp1 NA18953.hp1 NA18967.hp1 NA19012.hp1	intron_variant	MODIFIER	c.-88-377dupT c.-88-377dupT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154292581
chrX:154292581	CA CA	C C	4	a0001c0001t0001g0001 a0001c0001t0001g0009 a0001c0001t0001g0014 others(1): Show a0001c0001t0001g0001 a0001c0001t0001g0009 a0001c0001t0001g0014 a0001c0001t0001g0015	4	HG02145.hp1 HG02965.hp1 NA19075.hp1 others(1): Show HG02145.hp1 HG02965.hp1 NA19075.hp1 NA19088.hp1	intron_variant	MODIFIER	c.-88-377delT c.-88-377delT	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154292581
chrX:154292937	A A	G G	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.-88-732T>C c.-88-732T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154292937
chrX:154292941	C C	CG CG	8	a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0004 others(5): Show a0001c0001t0001g0001 a0001c0001t0001g0003 a0001c0001t0001g0004 a0001c0001t0001g0005 a0001c0001t0001g0006 a0001c0001t0001g0007 a0001c0001t0001g0008 a0001c0001t0001g0014	8	HG02145.hp1 HG04199.hp1 HG04228.hp1 others(5): Show HG02145.hp1 HG04199.hp1 HG04228.hp1 NA18953.hp1 NA19012.hp1 NA19068.hp1 NA19085.hp1 NA19088.hp1	intron_variant	MODIFIER	c.-88-737dupC c.-88-737dupC	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154292941
chrX:154292948	G G	T T	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.-88-743C>A c.-88-743C>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154292948
chrX:154293116	G G	A A	1	a0001c0001t0001g0014 a0001c0001t0001g0014	1	HG02145.hp1 HG02145.hp1	intron_variant	MODIFIER	c.-88-911C>T c.-88-911C>T	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154293116
chrX:154293121	C C	T T	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.-88-916G>A c.-88-916G>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154293121
chrX:154293373	A A	T T	1	a0001c0001t0001g0001 a0001c0001t0001g0001	1	NA19088.hp1 NA19088.hp1	intron_variant	MODIFIER	c.-88-1168T>A c.-88-1168T>A	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154293373
chrX:154293615	A A	G G	2	a0001c0001t0001g0001 a0001c0001t0001g0015 a0001c0001t0001g0001 a0001c0001t0001g0015	2	HG02965.hp1 NA19088.hp1 HG02965.hp1 NA19088.hp1	intron_variant	MODIFIER	c.-88-1410T>C c.-88-1410T>C	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154293615
chrX:154294469	T T	C C	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.-89+561A>G c.-89+561A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154294469
chrX:154294776	T T	C C	1	a0001c0001t0001g0015 a0001c0001t0001g0015	1	HG02965.hp1 HG02965.hp1	intron_variant	MODIFIER	c.-89+254A>G c.-89+254A>G	TEX28	ENSG00000278057.4	transcript	ENST00000617225.5	protein_coding	1/4	chrX	154294776

Search by Genic region

Search

JoGo Haplotype Explorer

TEX28_chrX_154266265_154300124 Genic Haplotype Structure on iGV

Translation Multiple Alignment View

Gene Summary (with MANE)

Amino acid(protein) Level Haplotype Info (Total: 1)

Coding Level Haplotype Info (Total: 1)

Transcript Level Haplotype Info (Total: 1)

Genebody Level Haplotype Info (Total: 15)

Haplotype Details by Sample (Haploid Level) (Total: 15)

Amino acid(protein) Level Haplotype Related Variants (Effect to Protein Coding Variants) (Total: 0)

Coding Level Variants (On coding region but no effect to protein coding variants: Synonymous Mutations) (Total: 0)

Transcript Level Haplotype Variants (Exon) (Total: 0)

Genebody Level Haplotype Variants (Intron) (Total: 95)

Annotation (Repeats)

Annotation (SNP Array)